Lineage for d4jpkl1 (4jpk L:1-109)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295867Species Escherichia coli [TaxId:562] [224856] (13 PDB entries)
  8. 1295884Domain d4jpkl1: 4jpk L:1-109 [235031]
    Other proteins in same PDB: d4jpkl2
    automated match to d1n0xl1
    complexed with nag

Details for d4jpkl1

PDB Entry: 4jpk (more details), 2.4 Å

PDB Description: crystal structure of the germline-targeting hiv-1 gp120 engineered outer domain eod-gt6 in complex with a putative vrc01 germline precursor fab
PDB Compounds: (L:) Putative VRC01 germline precursor Fab light chain

SCOPe Domain Sequences for d4jpkl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jpkl1 b.1.1.0 (L:1-109) automated matches {Escherichia coli [TaxId: 562]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleik

SCOPe Domain Coordinates for d4jpkl1:

Click to download the PDB-style file with coordinates for d4jpkl1.
(The format of our PDB-style files is described here.)

Timeline for d4jpkl1: