SCOPe 2.08: Domain d4jpkl1: 4jpk L:1-109

Lineage for d4jpkl1 (4jpk L:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4jpkl1: 4jpk L:1-109 [235031]
   Other proteins in same PDB: d4jpkl2
   automated match to d1n0xl1
   complexed with nag

Details for d4jpkl1

PDB Entry: 4jpk, 2.4 Å

PDB Description: crystal structure of the germline-targeting hiv-1 gp120 engineered outer domain eod-gt6 in complex with a putative vrc01 germline precursor fab

PDB Compounds: (L:) Putative VRC01 germline precursor Fab light chain

SCOPe Domain Sequences for d4jpkl1:

Sequence; same for both SEQRES and ATOM records:

>d4jpkl1 b.1.1.0 (L:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleik

Timeline for d4jpkl1:

• d4jpkl1 first appeared in SCOPe 2.03
  
• d4jpkl1 appears in SCOPe 2.07