| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries) |
| Domain d4jo3m1: 4jo3 M:1-107 [235024] automated match to d2dtgb1 complexed with so4 |
PDB Entry: 4jo3 (more details), 2.6 Å
SCOPe Domain Sequences for d4jo3m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jo3m1 b.1.1.0 (M:1-107) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
divmtqtpasvsaavggtvtincqasetisnylawyqqkpgqppklliykastlasgvss
rfkgsgsgteytltisgvqcddaatyycqqgysisdidnsfgggtevvvk
Timeline for d4jo3m1:
View in 3DDomains from other chains: (mouse over for more information) d4jo3h_, d4jo3i_, d4jo3l1, d4jo3l2 |