Lineage for d4jo2l2 (4jo2 L:109-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)
  8. 2761498Domain d4jo2l2: 4jo2 L:109-211 [235021]
    automated match to d3lmjl2
    complexed with ca

Details for d4jo2l2

PDB Entry: 4jo2 (more details), 2.5 Å

PDB Description: crystal structure of rabbit mab r56 fab in complex with v3 crown of hiv-1 consensus a gp120
PDB Compounds: (L:) monoclonal anti-HIV-1 gp120 V3 antibody R56 light chain

SCOPe Domain Sequences for d4jo2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jo2l2 b.1.1.0 (L:109-211) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dpvaptvlifppaadqvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqnsa
dctynlsstltltstqynshkeytckvtqgttsvvqsfnrgdc

SCOPe Domain Coordinates for d4jo2l2:

Click to download the PDB-style file with coordinates for d4jo2l2.
(The format of our PDB-style files is described here.)

Timeline for d4jo2l2: