SCOPe 2.08: Domain d4jo2m1: 4jo2 M:2-108

Lineage for d4jo2m1 (4jo2 M:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d4jo2m1: 4jo2 M:2-108 [235018]
   automated match to d3lmjl1
   complexed with ca

Details for d4jo2m1

PDB Entry: 4jo2, 2.5 Å

PDB Description: crystal structure of rabbit mab r56 fab in complex with v3 crown of hiv-1 consensus a gp120

PDB Compounds: (M:) monoclonal anti-HIV-1 gp120 V3 antibody R56 light chain

SCOPe Domain Sequences for d4jo2m1:

Sequence; same for both SEQRES and ATOM records:

>d4jo2m1 b.1.1.0 (M:2-108) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qvltqtpssvstavgsavtincqssqnvysnnnlawfqqkpgqpprlliydasklasgvp
srfkgsgsgtqftftisdvqcddaatfyclggydcssgdcaafgggtevvvrg

Timeline for d4jo2m1:

• d4jo2m1 first appeared in SCOPe 2.03
  
• d4jo2m1 appears in SCOPe 2.07