| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
| Family a.118.3.0: automated matches [191673] (1 protein) not a true family |
| Protein automated matches [191283] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries) |
| Domain d4jmoa1: 4jmo A:56-246 [235017] Other proteins in same PDB: d4jmoa2 automated match to d4jmia_ complexed with jaf |
PDB Entry: 4jmo (more details), 1.8 Å
SCOPe Domain Sequences for d4jmoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jmoa1 a.118.3.0 (A:56-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdyl
gereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcn
pgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrnly
dsirnepfkip
Timeline for d4jmoa1: