Lineage for d4jjga2 (4jjg A:245-344)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334937Species Methanothermobacter marburgensis [TaxId:79929] [235008] (4 PDB entries)
  8. 2334941Domain d4jjga2: 4jjg A:245-344 [235014]
    Other proteins in same PDB: d4jjga1, d4jjgb1
    automated match to d2b0ja1
    complexed with fe9, ic9

Details for d4jjga2

PDB Entry: 4jjg (more details), 2.5 Å

PDB Description: Crystal structure of FE-hydrogenase from methanothermobacter marburgensis in complex with toluenesulfonylmethylisocyanide
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d4jjga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jjga2 a.100.1.0 (A:245-344) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
aellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalmekvgi
dkmeenldpgallgtadsmnfgasaeilptvfeilekrkk

SCOPe Domain Coordinates for d4jjga2:

Click to download the PDB-style file with coordinates for d4jjga2.
(The format of our PDB-style files is described here.)

Timeline for d4jjga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jjga1