Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (35 species) not a true protein |
Species Methanothermobacter marburgensis [TaxId:79929] [235008] (2 PDB entries) |
Domain d4jjga2: 4jjg A:245-344 [235014] Other proteins in same PDB: d4jjga1, d4jjgb1 automated match to d2b0ja1 complexed with fe9, ic9 |
PDB Entry: 4jjg (more details), 2.5 Å
SCOPe Domain Sequences for d4jjga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jjga2 a.100.1.0 (A:245-344) automated matches {Methanothermobacter marburgensis [TaxId: 79929]} aellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalmekvgi dkmeenldpgallgtadsmnfgasaeilptvfeilekrkk
Timeline for d4jjga2: