SCOPe 2.04: Domain d4jjga2: 4jjg A:245-344

Lineage for d4jjga2 (4jjg A:245-344)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:79929] [235008] (2 PDB entries)

8. Domain d4jjga2: 4jjg A:245-344 [235014]
   Other proteins in same PDB: d4jjga1, d4jjgb1
   automated match to d2b0ja1
   complexed with fe9, ic9

Details for d4jjga2

PDB Entry: 4jjg, 2.5 Å

PDB Description: Crystal structure of FE-hydrogenase from methanothermobacter marburgensis in complex with toluenesulfonylmethylisocyanide

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d4jjga2:

Sequence; same for both SEQRES and ATOM records:

>d4jjga2 a.100.1.0 (A:245-344) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
aellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalmekvgi
dkmeenldpgallgtadsmnfgasaeilptvfeilekrkk

Timeline for d4jjga2:

• d4jjga2 first appeared in SCOPe 2.03
  
• d4jjga2 appears in SCOPe 2.05
  
• d4jjga2 appears in the current release, SCOPe 2.08