Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Methanothermobacter marburgensis [TaxId:79929] [235006] (4 PDB entries) |
Domain d4jjgb1: 4jjg B:1-244 [235013] Other proteins in same PDB: d4jjga2, d4jjgb2 automated match to d2b0ja2 complexed with fe9, ic9 |
PDB Entry: 4jjg (more details), 2.5 Å
SCOPe Domain Sequences for d4jjgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jjgb1 c.2.1.0 (B:1-244) automated matches {Methanothermobacter marburgensis [TaxId: 79929]} mklailgagcyrthaasgitnfsracevaemvgkpeiamthstitmgaelkelagvdevv vadpvfdnqftviddfayedvieahkedpekimpqirekvnevakelpkppegaihfthp edlgfeittddreavadadfimtwfpkgdmqpdiinkfiddikpgaivthactipttkfy kifeqkhgdlvtkpetlnvtsyhpgavpemkgqvyiaegyasedaietlfelgqkargna yrlp
Timeline for d4jjgb1: