SCOPe 2.04: Domain d4jjga1: 4jjg A:1-244

Lineage for d4jjga1 (4jjg A:1-244)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:79929] [235006] (2 PDB entries)

8. Domain d4jjga1: 4jjg A:1-244 [235012]
   Other proteins in same PDB: d4jjga2, d4jjgb2
   automated match to d2b0ja2
   complexed with fe9, ic9

Details for d4jjga1

PDB Entry: 4jjg, 2.5 Å

PDB Description: Crystal structure of FE-hydrogenase from methanothermobacter marburgensis in complex with toluenesulfonylmethylisocyanide

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d4jjga1:

Sequence; same for both SEQRES and ATOM records:

>d4jjga1 c.2.1.0 (A:1-244) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
mklailgagcyrthaasgitnfsracevaemvgkpeiamthstitmgaelkelagvdevv
vadpvfdnqftviddfayedvieahkedpekimpqirekvnevakelpkppegaihfthp
edlgfeittddreavadadfimtwfpkgdmqpdiinkfiddikpgaivthactipttkfy
kifeqkhgdlvtkpetlnvtsyhpgavpemkgqvyiaegyasedaietlfelgqkargna
yrlp

Timeline for d4jjga1:

• d4jjga1 first appeared in SCOPe 2.03
  
• d4jjga1 appears in SCOPe 2.05
  
• d4jjga1 appears in the current release, SCOPe 2.08