Lineage for d2rmu1_ (2rmu 1:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 protein domains)
  6. 11706Protein Rhinovirus coat protein [49670] (5 species)
  7. 11707Species Human rhinovirus 14 [TaxId:12131] [49671] (27 PDB entries)
  8. 11774Domain d2rmu1_: 2rmu 1: [23501]

Details for d2rmu1_

PDB Entry: 2rmu (more details), 3 Å

PDB Description: three-dimensional structures of drug-resistant mutants of human rhinovirus 14

SCOP Domain Sequences for d2rmu1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmu1_ b.10.1.4 (1:) Rhinovirus coat protein {Human rhinovirus 14}
tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfslpyvglasa
yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
apralpytsigrtnypkntepvikkrkgdiksy

SCOP Domain Coordinates for d2rmu1_:

Click to download the PDB-style file with coordinates for d2rmu1_.
(The format of our PDB-style files is described here.)

Timeline for d2rmu1_: