SCOPe 2.08: Domain d4jh7b_: 4jh7 B:

Lineage for d4jh7b_ (4jh7 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Bacillus cereus [TaxId:222523] [228045] (9 PDB entries)

8. Domain d4jh7b_: 4jh7 B: [235001]
   automated match to d4jh2a_
   complexed with 1km, fmt, mg, mn

Details for d4jh7b_

PDB Entry: 4jh7, 1.55 Å

PDB Description: crystal structure of fosb from bacillus cereus with manganese and l- cysteine-fosfomycin product

PDB Compounds: (B:) Metallothiol transferase FosB

SCOPe Domain Sequences for d4jh7b_:

Sequence; same for both SEQRES and ATOM records:

>d4jh7b_ d.32.1.0 (B:) automated matches {Bacillus cereus [TaxId: 222523]}
mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
lqdrlnyyredkphmtfy

Timeline for d4jh7b_:

• d4jh7b_ first appeared in SCOPe 2.03
  
• d4jh7b_ appears in SCOPe 2.07