![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
![]() | Protein automated matches [190734] (7 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [226583] (2 PDB entries) |
![]() | Domain d4jg3a_: 4jg3 A: [234986] automated match to d2jc5a_ complexed with cl |
PDB Entry: 4jg3 (more details), 1.8 Å
SCOPe Domain Sequences for d4jg3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jg3a_ d.151.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} gpamriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflya cdaelpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgde slnqkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperaw ldevfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnakl prqprfsqhaplivdydwqlsi
Timeline for d4jg3a_: