Lineage for d4jeqg_ (4jeq G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2079038Species Trypanosoma cruzi [TaxId:5693] [228042] (2 PDB entries)
  8. 2079047Domain d4jeqg_: 4jeq G: [234980]
    automated match to d4jeqf_
    complexed with peg, so4

Details for d4jeqg_

PDB Entry: 4jeq (more details), 2.3 Å

PDB Description: Different Contribution of Conserved Amino Acids to the Global Properties of Homologous Enzymes
PDB Compounds: (G:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d4jeqg_:

Sequence, based on SEQRES records: (download)

>d4jeqg_ c.1.1.0 (G:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
efvdiikatq

Sequence, based on observed residues (ATOM records): (download)

>d4jeqg_ c.1.1.0 (G:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwavatpqqaqe
ahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdi
ikatq

SCOPe Domain Coordinates for d4jeqg_:

Click to download the PDB-style file with coordinates for d4jeqg_.
(The format of our PDB-style files is described here.)

Timeline for d4jeqg_: