Lineage for d4jeqa_ (4jeq A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2090118Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2090119Protein automated matches [190605] (21 species)
    not a true protein
  7. 2090256Species Trypanosoma cruzi [TaxId:5693] [228042] (2 PDB entries)
  8. 2090259Domain d4jeqa_: 4jeq A: [234974]
    automated match to d4jeqf_
    complexed with peg, so4

Details for d4jeqa_

PDB Entry: 4jeq (more details), 2.3 Å

PDB Description: Different Contribution of Conserved Amino Acids to the Global Properties of Homologous Enzymes
PDB Compounds: (A:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d4jeqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jeqa_ c.1.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
efvdiikatq

SCOPe Domain Coordinates for d4jeqa_:

Click to download the PDB-style file with coordinates for d4jeqa_.
(The format of our PDB-style files is described here.)

Timeline for d4jeqa_: