SCOPe 2.08: Domain d4jcua1: 4jcu A:1-128

Lineage for d4jcua1 (4jcu A:1-128)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [234969] (1 PDB entry)

8. Domain d4jcua1: 4jcu A:1-128 [234971]
   Other proteins in same PDB: d4jcua2, d4jcub2, d4jcuc2
   automated match to d1otga_

Details for d4jcua1

PDB Entry: 4jcu, 2.4 Å

PDB Description: Crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from Deinococcus radiodurans R1

PDB Compounds: (A:) 5-carboxymethyl-2-hydroxymuconate isomerase

SCOPe Domain Sequences for d4jcua1:

Sequence; same for both SEQRES and ATOM records:

>d4jcua1 d.80.1.0 (A:1-128) automated matches {Deinococcus radiodurans [TaxId: 243230]}
mphltleytdnlpepripellqklngvllarpdifpvggirarayrlseyaladssepsd
afvhlrlqigagrseevkketgdalfavltdhfaaefaqrglmlsaeisefseagtwkkn
niharyrk

Timeline for d4jcua1:

• d4jcua1 first appeared in SCOPe 2.03, called d4jcua_
  
• d4jcua1 appears in SCOPe 2.07