Lineage for d4jcsa1 (4jcs A:1-264)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100095Species Cupriavidus metallidurans [TaxId:266264] [234967] (1 PDB entry)
  8. 2100096Domain d4jcsa1: 4jcs A:1-264 [234968]
    Other proteins in same PDB: d4jcsa2
    automated match to d2uzfa_

Details for d4jcsa1

PDB Entry: 4jcs (more details), 1.77 Å

PDB Description: Crystal structure of Enoyl-CoA hydratase/isomerase from Cupriavidus metallidurans CH34
PDB Compounds: (A:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4jcsa1:

Sequence, based on SEQRES records: (download)

>d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}
mdtldfevvnnvgwirmnraakhnpfdaelradlmtvlervrddadirvlvltshpgsfc
aggnlhvlrdnldsgpaywqqriktglrfihdmlnlgrpviaavdgpafgagfalsltad
ivlasprarfsmaylrlglvpdlgalyllpravglqrakelmfstreldaeeahrlglvm
evhesealeqrareiaeslvqaaptalaltkaalnvsldsdeqtmfsleaasqaaafstk
epraaieallskqpppfrgfprrs

Sequence, based on observed residues (ATOM records): (download)

>d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}
mdtldfevvnnvgwirmnraakhnpfdaelradlmtvlervrddadirvlvltshpgsfc
anlhvlrdnldsgpaywqqriktglrfihdmlnlgrpviaavdgpafgagfalsltadiv
lasprarfsmaylrlglvpdlgalyllpravglqrakelmfstreldaeeahrlglvmev
hesealeqrareiaeslvqaaptalaltkaalnvsldsdeqtmfsleaasqaaafstkep
raaieallskqpppfrgfprrs

SCOPe Domain Coordinates for d4jcsa1:

Click to download the PDB-style file with coordinates for d4jcsa1.
(The format of our PDB-style files is described here.)

Timeline for d4jcsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jcsa2