SCOPe 2.08: Domain d4jcib_: 4jci B:

Lineage for d4jcib_ (4jci B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [234963] (1 PDB entry)

8. Domain d4jcib_: 4jci B: [234965]
   Other proteins in same PDB: d4jcia2
   automated match to d2azpa_
   complexed with na

Details for d4jcib_

PDB Entry: 4jci, 1.7 Å

PDB Description: crystal structure of csal_2705, a putative hydroxyproline epimerase from chromohalobacter salexigens (target efi-506486), space group p212121, unliganded

PDB Compounds: (B:) proline racemase

SCOPe Domain Sequences for d4jcib_:

Sequence; same for both SEQRES and ATOM records:

>d4jcib_ d.21.1.0 (B:) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
mkrvhvidshtageptrlvmegmpalsgrtiaekcddfrdnhdawrraimleprghdvlv
galycapessdascgviffnnsgylgmcghgtiglvaslhhlgqltpgchkidtpagpvs
atlhddgavtvrnvlsyrhrrrvpvevpgygtvhgdiawggnwfflvsdhdmtleldnve
altdytwairqaleaqsitgenggvidhielfcddreadsrnfvlcpgkaydrspcgtgt
saklaclaadgklapgqvwtqasicgsrfeafyeregdgirpsikgraylsadatllide
rdpfawgi

Timeline for d4jcib_:

• d4jcib_ first appeared in SCOPe 2.03
  
• d4jcib_ appears in SCOPe 2.07