Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (18 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:290398] [234963] (1 PDB entry) |
Domain d4jcia1: 4jci A:1-309 [234964] Other proteins in same PDB: d4jcia2 automated match to d2azpa_ complexed with na |
PDB Entry: 4jci (more details), 1.7 Å
SCOPe Domain Sequences for d4jcia1:
Sequence, based on SEQRES records: (download)
>d4jcia1 d.21.1.0 (A:1-309) automated matches {Chromohalobacter salexigens [TaxId: 290398]} mkrvhvidshtageptrlvmegmpalsgrtiaekcddfrdnhdawrraimleprghdvlv galycapessdascgviffnnsgylgmcghgtiglvaslhhlgqltpgchkidtpagpvs atlhddgavtvrnvlsyrhrrrvpvevpgygtvhgdiawggnwfflvsdhdmtleldnve altdytwairqaleaqsitgenggvidhielfcddreadsrnfvlcpgkaydrspcgtgt saklaclaadgklapgqvwtqasicgsrfeafyeregdgirpsikgraylsadatllide rdpfawgia
>d4jcia1 d.21.1.0 (A:1-309) automated matches {Chromohalobacter salexigens [TaxId: 290398]} mkrvhvidshtageptrlvmegmpalsgrtiaekcddfrdnhdawrraimleprghdvlv galycapessdascgviffnnsgylgmcghgtiglvaslhhlgqltpgchkidtpagpvs atlhddgavtvrnvlsyrhrrrvpvevpgygtvhgdiawggnwfflvsddmtleldnvea ltdytwairqaleaqsitgenggvidhielfcddreadsrnfvlcpgkaydrspcgtgts aklaclaadgklapgqvwtqasicgsrfeafyeregdgirpsikgraylsadatllider dpfawgia
Timeline for d4jcia1: