Lineage for d4jcca_ (4jcc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878032Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1878139Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1878387Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 1878388Protein automated matches [190944] (28 species)
    not a true protein
  7. 1878481Species Streptococcus pneumoniae [TaxId:637987] [234961] (1 PDB entry)
  8. 1878482Domain d4jcca_: 4jcc A: [234962]
    automated match to d3tefa_
    complexed with cl, ipa, so4

Details for d4jcca_

PDB Entry: 4jcc (more details), 1.13 Å

PDB Description: Crystal structure of iron uptake ABC transporter substrate-binding protein PiuA from Streptococcus pneumoniae Canada MDR_19A
PDB Compounds: (A:) Iron-compound ABC transporter, iron-compound-binding protein

SCOPe Domain Sequences for d4jcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jcca_ c.92.2.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
saptevtikssldevklskvpekivtfdlgaadtiralgfaknivgmptktvptylkdlv
gtvknvgsmkepdleaiaalepdliiasprtqkfvdkfkeiaptvlfqaskddywtstka
nieslasafgetgtqkakeelakldesiqevatknessdkkalaillnegkmaafgaksr
fsflyqtlkfkptdtkfedsrhgqevsfesvkeinpdilfvinrtlaiggdnssndgvle
naliaetpaakngkiiqltpdlwylsggglestklmiediqkal

SCOPe Domain Coordinates for d4jcca_:

Click to download the PDB-style file with coordinates for d4jcca_.
(The format of our PDB-style files is described here.)

Timeline for d4jcca_: