SCOPe 2.06: Domain d4jbmb2: 4jbm B:98-187

Lineage for d4jbmb2 (4jbm B:98-187)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.0: automated matches [233467] (1 protein)
   not a true family

6. Protein automated matches [233468] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234954] (4 PDB entries)

8. Domain d4jbmb2: 4jbm B:98-187 [234958]
   Other proteins in same PDB: d4jbma3, d4jbmb3
   automated match to d2oq0a1
   protein/DNA complex

Details for d4jbmb2

PDB Entry: 4jbm, 2.22 Å

PDB Description: Structure of murine DNA binding protein bound with ds DNA

PDB Compounds: (B:) Interferon-inducible protein AIM2

SCOPe Domain Sequences for d4jbmb2:

Sequence; same for both SEQRES and ATOM records:

>d4jbmb2 b.40.16.0 (B:98-187) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prisklkiqpcgtivnglfkvqkiteekdrvlygihdktgtmevlvlgnpsktkceegdk
irltffevskngvkiqlksgpcsffkvika

Timeline for d4jbmb2:

• d4jbmb2 first appeared in SCOPe 2.03
  
• d4jbmb2 appears in SCOPe 2.05
  
• d4jbmb2 appears in SCOPe 2.07
  
• d4jbmb2 appears in the current release, SCOPe 2.08