Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (18 species) not a true protein |
Species Entamoeba histolytica [TaxId:294381] [225437] (5 PDB entries) |
Domain d4jblb_: 4jbl B: [234953] automated match to d4jbla_ complexed with met, so4 |
PDB Entry: 4jbl (more details), 2 Å
SCOPe Domain Sequences for d4jblb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jblb_ c.79.1.0 (B:) automated matches {Entamoeba histolytica [TaxId: 294381]} eqisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdrv gfnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmimk afgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedtd gevdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigagf ipdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegkt iviivpscgerylstdlykikdegtkiqildslln
Timeline for d4jblb_: