Lineage for d4jbab_ (4jba B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722146Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1722246Protein automated matches [190294] (4 species)
    not a true protein
  7. 1722251Species Escherichia coli K-12 [TaxId:83333] [193218] (4 PDB entries)
  8. 1722257Domain d4jbab_: 4jba B: [234952]
    automated match to d4jbaa_

Details for d4jbab_

PDB Entry: 4jba (more details), 2.5 Å

PDB Description: Crystal Structure of the Oxidized Form of MarR from E.coli
PDB Compounds: (B:) multiple antibiotic resistance protein marr

SCOPe Domain Sequences for d4jbab_:

Sequence, based on SEQRES records: (download)

>d4jbab_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvls
vdlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlhqeltk
nltadevatleyllkkvlp

Sequence, based on observed residues (ATOM records): (download)

>d4jbab_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvls
vdlgaltrmldrlvckgwverlpnpngvlvklttggaaiseqshqlvgqdlhqeltknlt
adevatleyllkkvlp

SCOPe Domain Coordinates for d4jbab_:

Click to download the PDB-style file with coordinates for d4jbab_.
(The format of our PDB-style files is described here.)

Timeline for d4jbab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4jbaa_