SCOPe 2.07: Domain d4jbab_: 4jba B:

Lineage for d4jbab_ (4jba B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 protein domains)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [190294] (6 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [193218] (4 PDB entries)

8. Domain d4jbab_: 4jba B: [234952]
   automated match to d4jbaa_

Details for d4jbab_

PDB Entry: 4jba, 2.5 Å

PDB Description: Crystal Structure of the Oxidized Form of MarR from E.coli

PDB Compounds: (B:) multiple antibiotic resistance protein marr

SCOPe Domain Sequences for d4jbab_:

Sequence, based on SEQRES records:

>d4jbab_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvls
vdlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlhqeltk
nltadevatleyllkkvlp

Sequence, based on observed residues (ATOM records):

>d4jbab_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvls
vdlgaltrmldrlvckgwverlpnpngvlvklttggaaiseqshqlvgqdlhqeltknlt
adevatleyllkkvlp

Timeline for d4jbab_:

• d4jbab_ first appeared in SCOPe 2.03
  
• d4jbab_ appears in SCOPe 2.06