SCOPe 2.03: Domain d4jaka_: 4jak A:

Lineage for d4jaka_ (4jak A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [234948] (2 PDB entries)

8. Domain d4jaka_: 4jak A: [234949]
   automated match to d4kgnd_

Details for d4jaka_

PDB Entry: 4jak, 2 Å

PDB Description: Crystal structure of tRNA (Um34/Cm34) methyltransferase TrmL from Escherichia coli

PDB Compounds: (A:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4jaka_:

Sequence; same for both SEQRES and ATOM records:

>d4jaka_ c.116.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
malnivlyepeippntgniirlcantgfrlhiiepmgfawddkrlrragldyheftavtr
hhdyrafleaenpqrlfalttkgtpahsavsyqdgdylmfgpetrglpasildalpaeqk
iripmvpdsrsmnlsnavsvvvyeawrqlgypgav

Timeline for d4jaka_:

• d4jaka_ is new in SCOPe 2.03-stable
  
• d4jaka_ appears in SCOPe 2.04
  
• d4jaka_ appears in the current release, SCOPe 2.08, called d4jaka1