Lineage for d4j95b_ (4j95 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219537Protein Fibroblast growth factor receptor 2 [75562] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2219538Species Human (Homo sapiens) [TaxId:9606] [75563] (16 PDB entries)
    Uniprot P21802 467-765
  8. 2219551Domain d4j95b_: 4j95 B: [234944]
    automated match to d2pvyb_
    complexed with acp, so4; mutant

Details for d4j95b_

PDB Entry: 4j95 (more details), 2.38 Å

PDB Description: crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic k659n mutation responsible for an unclassified craniosynostosis syndrome in space group c2.
PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d4j95b_:

Sequence, based on SEQRES records: (download)

>d4j95b_ d.144.1.7 (B:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
lpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatekd
lsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmeys
ydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfgl
ardinnidyyknttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgi
pveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

Sequence, based on observed residues (ATOM records): (download)

>d4j95b_ d.144.1.7 (B:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
lpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatekd
lsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrpqmtfkd
lvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyyknttn
grlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeghrm
dkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

SCOPe Domain Coordinates for d4j95b_:

Click to download the PDB-style file with coordinates for d4j95b_.
(The format of our PDB-style files is described here.)

Timeline for d4j95b_: