SCOPe 2.07: Domain d4j9wb_: 4j9w B:

Lineage for d4j9wb_ (4j9w B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Pseudomonas protegens [TaxId:220664] [234939] (2 PDB entries)

8. Domain d4j9wb_: 4j9w B: [234941]
   automated match to d2azpa_
   complexed with gol, na, pyc

Details for d4j9wb_

PDB Entry: 4j9w, 1.6 Å

PDB Description: crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with the inhibitor pyrrole-2-carboxylate

PDB Compounds: (B:) Proline racemase family protein

SCOPe Domain Sequences for d4j9wb_:

Sequence; same for both SEQRES and ATOM records:

>d4j9wb_ d.21.1.0 (B:) automated matches {Pseudomonas protegens [TaxId: 220664]}
mkkitvidshtggeptrlvidgfpdlgrgsmaerlqilerehdqwrracvleprgsdvlv
gallcqpqagdacagviffnnsgylgmcghgtiglvrslyhlgridqgvhrietpvgtve
atlhedlsvsvrnvpayryrtqvmlqlpghgkvhgdiawggnwfflisdhgqrialdnve
althytrdvrqaleaagitgaeggvidhielfaddpqadsrnfvlcpgkaydrspcgtgt
saklaclaadgklapgqawrqasvigsqfsahyekvgeqlipilrgsahisaeatllldd
sdpfvwgigs

Timeline for d4j9wb_:

• d4j9wb_ first appeared in SCOPe 2.03
  
• d4j9wb_ appears in SCOPe 2.06
  
• d4j9wb_ appears in the current release, SCOPe 2.08