Lineage for d4j9wb_ (4j9w B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898719Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1898720Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1898822Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 1898823Protein automated matches [190491] (13 species)
    not a true protein
  7. 1898857Species Pseudomonas protegens [TaxId:220664] [234939] (2 PDB entries)
  8. 1898859Domain d4j9wb_: 4j9w B: [234941]
    automated match to d2azpa_
    complexed with gol, na, pyc

Details for d4j9wb_

PDB Entry: 4j9w (more details), 1.6 Å

PDB Description: crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with the inhibitor pyrrole-2-carboxylate
PDB Compounds: (B:) Proline racemase family protein

SCOPe Domain Sequences for d4j9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j9wb_ d.21.1.0 (B:) automated matches {Pseudomonas protegens [TaxId: 220664]}
mkkitvidshtggeptrlvidgfpdlgrgsmaerlqilerehdqwrracvleprgsdvlv
gallcqpqagdacagviffnnsgylgmcghgtiglvrslyhlgridqgvhrietpvgtve
atlhedlsvsvrnvpayryrtqvmlqlpghgkvhgdiawggnwfflisdhgqrialdnve
althytrdvrqaleaagitgaeggvidhielfaddpqadsrnfvlcpgkaydrspcgtgt
saklaclaadgklapgqawrqasvigsqfsahyekvgeqlipilrgsahisaeatllldd
sdpfvwgigs

SCOPe Domain Coordinates for d4j9wb_:

Click to download the PDB-style file with coordinates for d4j9wb_.
(The format of our PDB-style files is described here.)

Timeline for d4j9wb_: