Lineage for d4j8tb_ (4j8t B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936970Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 2936985Protein Uncharacterized protein PA3332 [159977] (1 species)
  7. 2936986Species Pseudomonas aeruginosa [TaxId:287] [159978] (2 PDB entries)
    Uniprot Q9HYR3 1-129
  8. 2936989Domain d4j8tb_: 4j8t B: [234938]
    automated match to d1z1sa1
    complexed with dog

Details for d4j8tb_

PDB Entry: 4j8t (more details), 2.05 Å

PDB Description: engineered digoxigenin binder dig10.2
PDB Compounds: (B:) Engineered Digoxigenin binder protein DIG10.2

SCOPe Domain Sequences for d4j8tb_:

Sequence, based on SEQRES records: (download)

>d4j8tb_ d.17.4.10 (B:) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}
nakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpey
mtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffnp
lrvl

Sequence, based on observed residues (ATOM records): (download)

>d4j8tb_ d.17.4.10 (B:) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}
nakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpey
mtirftdvqfyetadpdlaigefhgdgvhtvklaadyisvlrtrdgqillyrlffnplrv
l

SCOPe Domain Coordinates for d4j8tb_:

Click to download the PDB-style file with coordinates for d4j8tb_.
(The format of our PDB-style files is described here.)

Timeline for d4j8tb_: