Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins) |
Protein Uncharacterized protein PA3332 [159977] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [159978] (2 PDB entries) Uniprot Q9HYR3 1-129 |
Domain d4j8ta_: 4j8t A: [234937] automated match to d1z1sa1 complexed with dog |
PDB Entry: 4j8t (more details), 2.05 Å
SCOPe Domain Sequences for d4j8ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j8ta_ d.17.4.10 (A:) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe ymtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffn plrvlepl
Timeline for d4j8ta_: