Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (2 families) Serine/threonine protein kinase-associated motif embedded in two distinct folds |
Family d.223.1.2: Polo-box duplicated region [102856] (1 protein) duplication: consists of two polo-box domains; binds phosphothreonine peptide |
Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species) |
Species Zebrafish (Danio rerio) [TaxId:7955] [234931] (1 PDB entry) |
Domain d4j7be2: 4j7b E:492-585 [234935] Other proteins in same PDB: d4j7ba_, d4j7bd_ automated match to d3bzia2 |
PDB Entry: 4j7b (more details), 2.3 Å
SCOPe Domain Sequences for d4j7be2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j7be2 d.223.1.2 (E:492-585) Serine/threonine-protein kinase plk C-terminal domain {Zebrafish (Danio rerio) [TaxId: 7955]} egdeltrlpylrhwfrtksaivlhlsngtvqinffqdhtklilcplmgavtyinekrefy tykmtlieefgcckelasrlryarnmveklmack
Timeline for d4j7be2:
View in 3D Domains from other chains: (mouse over for more information) d4j7ba_, d4j7bb1, d4j7bb2, d4j7bd_ |