Class b: All beta proteins [48724] (176 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
Protein automated matches [190873] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries) |
Domain d4j6gb_: 4j6g B: [234930] automated match to d2re9a_ complexed with cl, mg, nag |
PDB Entry: 4j6g (more details), 2.4 Å
SCOPe Domain Sequences for d4j6gb_:
Sequence, based on SEQRES records: (download)
>d4j6gb_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea geevvvrvlderlvrlrdgtrsyfgafmv
>d4j6gb_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg vgcastithglykrtprypeelellvsqqspcgrvwwdssflggvvhleageevvvrvld erlvrlrdgtrsyfgafmv
Timeline for d4j6gb_: