SCOPe 2.05: Domain d4j6gb_: 4j6g B:

Lineage for d4j6gb_ (4j6g B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries)

8. Domain d4j6gb_: 4j6g B: [234930]
   automated match to d2re9a_
   complexed with cl, mg, nag

Details for d4j6gb_

PDB Entry: 4j6g, 2.4 Å

PDB Description: crystal structure of light and dcr3 complex

PDB Compounds: (B:) Tumor necrosis factor ligand superfamily member 14

SCOPe Domain Sequences for d4j6gb_:

Sequence, based on SEQRES records:

>d4j6gb_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea
geevvvrvlderlvrlrdgtrsyfgafmv

Sequence, based on observed residues (ATOM records):

>d4j6gb_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcastithglykrtprypeelellvsqqspcgrvwwdssflggvvhleageevvvrvld
erlvrlrdgtrsyfgafmv

Timeline for d4j6gb_:

• d4j6gb_ first appeared in SCOPe 2.03
  
• d4j6gb_ appears in SCOPe 2.04
  
• d4j6gb_ appears in SCOPe 2.06
  
• d4j6gb_ appears in the current release, SCOPe 2.08