Lineage for d4j5ua_ (4j5u A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132872Species Rickettsia rickettsii [TaxId:392021] [234926] (1 PDB entry)
  8. 2132873Domain d4j5ua_: 4j5u A: [234928]
    automated match to d3n0lb_

Details for d4j5ua_

PDB Entry: 4j5u (more details), 1.7 Å

PDB Description: X-ray crystal structure of a serine hydroxymethyltransferase with covalently bound PLP from Rickettsia rickettsii str. Sheila Smith
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4j5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j5ua_ c.67.1.0 (A:) automated matches {Rickettsia rickettsii [TaxId: 392021]}
mnifnnnlhetdkeineiikheklrqssvieliasenfvspavleaqgalltnkyaegyp
skrfyngceevdkaenlaiervkklfnckyanvqphsgsqanqavylallqpgdtvlgms
ldsgghlthgaapnmsgkwfnavsysvnketylidydeierladlhkpklliagfsaypr
nidfakfreivdkvgayfmadiahiaglvatgehqspipyahavtstthktlrgprggli
lsndeeighkinsalfpglqggplmhiiaakavaflenlqpeyksyiqqvisnakalass
lqergydiltggtdnhivlvdlrkdgitgklaansldragitcnknaipfdetspfitsg
irlgtpacttrgfkekdfvlvghmvadildglknnednsaleqqvlnevtklielfpfyg

SCOPe Domain Coordinates for d4j5ua_:

Click to download the PDB-style file with coordinates for d4j5ua_.
(The format of our PDB-style files is described here.)

Timeline for d4j5ua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4j5ub_