SCOPe 2.05: Domain d4j1xa1: 4j1x A:6-76

Lineage for d4j1xa1 (4j1x A:6-76)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
   Uniprot Q56185 6-76

8. Domain d4j1xa1: 4j1x A:6-76 [234923]
   Other proteins in same PDB: d4j1xa2, d4j1xb2, d4j1xc2
   automated match to d1zz6a1
   complexed with 1jj, fe2, gol

Details for d4j1xa1

PDB Entry: 4j1x, 2.8 Å

PDB Description: Crystal Structure of Fe(II)-HppE with alternative substrate (S)-1-HPP

PDB Compounds: (A:) epoxidase

SCOPe Domain Sequences for d4j1xa1:

Sequence; same for both SEQRES and ATOM records:

>d4j1xa1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

Timeline for d4j1xa1:

• d4j1xa1 first appeared in SCOPe 2.03
  
• d4j1xa1 appears in SCOPe 2.04
  
• d4j1xa1 appears in SCOPe 2.06
  
• d4j1xa1 appears in the current release, SCOPe 2.08