Lineage for d4izaa_ (4iza A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544153Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544154Species Human (Homo sapiens) [TaxId:9606] [56135] (69 PDB entries)
  8. 2544157Domain d4izaa_: 4iza A: [234920]
    automated match to d4iz7c_

Details for d4izaa_

PDB Entry: 4iza (more details), 1.93 Å

PDB Description: Structure of Dually Phosphorylated ERK2 bound to the PEA-15 Death Effector Domain
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d4izaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4izaa_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy

SCOPe Domain Coordinates for d4izaa_:

Click to download the PDB-style file with coordinates for d4izaa_.
(The format of our PDB-style files is described here.)

Timeline for d4izaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4izac_