SCOPe 2.06: Domain d4ivfa1: 4ivf A:5-94

Lineage for d4ivfa1 (4ivf A:5-94)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Lodderomyces elongisporus [TaxId:379508] [234906] (1 PDB entry)

8. Domain d4ivfa1: 4ivf A:5-94 [234910]
   Other proteins in same PDB: d4ivfa2, d4ivfb2, d4ivfc2, d4ivfc3, d4ivfd2, d4ivfe2, d4ivfe3, d4ivff2, d4ivff3, d4ivfg2, d4ivfg3, d4ivfh2
   automated match to d4ecib1
   complexed with cit, gsh

Details for d4ivfa1

PDB Entry: 4ivf, 2.2 Å

PDB Description: crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4ivfa1:

Sequence; same for both SEQRES and ATOM records:

>d4ivfa1 c.47.1.0 (A:5-94) automated matches {Lodderomyces elongisporus [TaxId: 379508]}
lkpiklytaptpngykisiflevlgldyevqkfdlsknetkedwfvklnpngriptindp
nfkgvdgglvlsqtgailqyladtydkehk

Timeline for d4ivfa1:

• d4ivfa1 first appeared in SCOPe 2.03
  
• d4ivfa1 appears in SCOPe 2.05
  
• d4ivfa1 appears in SCOPe 2.07
  
• d4ivfa1 appears in the current release, SCOPe 2.08