SCOPe 2.05: Domain d4ivfb2: 4ivf B:95-222

Lineage for d4ivfb2 (4ivf B:95-222)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (51 species)
   not a true protein

7. Species Lodderomyces elongisporus [TaxId:379508] [234908] (1 PDB entry)

8. Domain d4ivfb2: 4ivf B:95-222 [234909]
   Other proteins in same PDB: d4ivfa1, d4ivfb1, d4ivfc1, d4ivfd1, d4ivfe1, d4ivff1, d4ivfg1, d4ivfh1
   automated match to d4ecib2
   complexed with cit, gsh

Details for d4ivfb2

PDB Entry: 4ivf, 2.2 Å

PDB Description: crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d4ivfb2:

Sequence; same for both SEQRES and ATOM records:

>d4ivfb2 a.45.1.0 (B:95-222) automated matches {Lodderomyces elongisporus [TaxId: 379508]}
fsypagtaeyyktleylifqvaengpiqgqanhfvfaakekvpyginryitdtkriygvf
edilsrnkandskylvgdrytvadfallgwayrlsrleidinqwpllgkwydsllklpav
qkgfevpp

Timeline for d4ivfb2:

• d4ivfb2 first appeared in SCOPe 2.03
  
• d4ivfb2 appears in SCOPe 2.04
  
• d4ivfb2 appears in SCOPe 2.06
  
• d4ivfb2 appears in the current release, SCOPe 2.08