Lineage for d4ivfb1 (4ivf B:5-94)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879959Species Lodderomyces elongisporus [TaxId:379508] [234906] (1 PDB entry)
  8. 2879961Domain d4ivfb1: 4ivf B:5-94 [234907]
    Other proteins in same PDB: d4ivfa2, d4ivfb2, d4ivfc2, d4ivfc3, d4ivfd2, d4ivfe2, d4ivfe3, d4ivff2, d4ivff3, d4ivfg2, d4ivfg3, d4ivfh2
    automated match to d4ecib1
    complexed with cit, gsh

Details for d4ivfb1

PDB Entry: 4ivf (more details), 2.2 Å

PDB Description: crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d4ivfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ivfb1 c.47.1.0 (B:5-94) automated matches {Lodderomyces elongisporus [TaxId: 379508]}
lkpiklytaptpngykisiflevlgldyevqkfdlsknetkedwfvklnpngriptindp
nfkgvdgglvlsqtgailqyladtydkehk

SCOPe Domain Coordinates for d4ivfb1:

Click to download the PDB-style file with coordinates for d4ivfb1.
(The format of our PDB-style files is described here.)

Timeline for d4ivfb1: