SCOPe 2.05: Domain d4ipja1: 4ipj A:-1-281

Lineage for d4ipja1 (4ipj A:-1-281)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.6: NeuB-like [110368] (3 proteins)
   Pfam PF03102

6. Protein automated matches [231473] (2 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:487] [234892] (2 PDB entries)

8. Domain d4ipja1: 4ipj A:-1-281 [234896]
   Other proteins in same PDB: d4ipja2
   automated match to d1xuua2
   complexed with lmr, mn

Details for d4ipja1

PDB Entry: 4ipj, 2.15 Å

PDB Description: Crystal Structure of R314K N-acetyl Neuraminic Acid Synthase from Neiserria meningitidis with Malate bound

PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d4ipja1:

Sequence; same for both SEQRES and ATOM records:

>d4ipja1 c.1.10.6 (A:-1-281) automated matches {Neisseria meningitidis [TaxId: 487]}
gamqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthi
vedemsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaal
rlqrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpya
llhctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhft
drmdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

Timeline for d4ipja1:

• d4ipja1 first appeared in SCOPe 2.03
  
• d4ipja1 appears in SCOPe 2.04
  
• d4ipja1 appears in SCOPe 2.06
  
• d4ipja1 appears in the current release, SCOPe 2.08