Lineage for d4ioie1 (4ioi E:20-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179961Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2179962Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2180069Protein automated matches [190067] (6 species)
    not a true protein
  7. 2180075Species Finegoldia magna [TaxId:1260] [188811] (5 PDB entries)
  8. 2180079Domain d4ioie1: 4ioi E:20-81 [234888]
    Other proteins in same PDB: d4ioia1, d4ioia2, d4ioie2, d4ioih1, d4ioih2
    automated match to d4hjge_

Details for d4ioie1

PDB Entry: 4ioi (more details), 1.95 Å

PDB Description: meditope-enabled trastuzumab in complex with cqfdlstrrlkc
PDB Compounds: (E:) protein l

SCOPe Domain Sequences for d4ioie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ioie1 d.15.7.1 (E:20-81) automated matches {Finegoldia magna [TaxId: 1260]}
evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnikf
ag

SCOPe Domain Coordinates for d4ioie1:

Click to download the PDB-style file with coordinates for d4ioie1.
(The format of our PDB-style files is described here.)

Timeline for d4ioie1: