Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein automated matches [190067] (6 species) not a true protein |
Species Finegoldia magna [TaxId:1260] [188811] (5 PDB entries) |
Domain d4ioie1: 4ioi E:20-81 [234888] Other proteins in same PDB: d4ioia1, d4ioia2, d4ioie2, d4ioih1, d4ioih2 automated match to d4hjge_ |
PDB Entry: 4ioi (more details), 1.95 Å
SCOPe Domain Sequences for d4ioie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ioie1 d.15.7.1 (E:20-81) automated matches {Finegoldia magna [TaxId: 1260]} evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnikf ag
Timeline for d4ioie1:
View in 3D Domains from other chains: (mouse over for more information) d4ioia1, d4ioia2, d4ioih1, d4ioih2 |