SCOPe 2.05: Domain d4imyb2: 4imy B:151-257

Lineage for d4imyb2 (4imy B:151-257)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin T1 [158595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
   Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150

8. Domain d4imyb2: 4imy B:151-257 [234885]
   Other proteins in same PDB: d4imya_, d4imyc_, d4imye_
   automated match to d2pk2a1
   complexed with amp

Details for d4imyb2

PDB Entry: 4imy, 2.94 Å

PDB Description: The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d4imyb2:

Sequence; same for both SEQRES and ATOM records:

>d4imyb2 a.74.1.1 (B:151-257) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwn

Timeline for d4imyb2:

• d4imyb2 first appeared in SCOPe 2.03
  
• d4imyb2 appears in SCOPe 2.04
  
• d4imyb2 appears in SCOPe 2.06
  
• d4imyb2 appears in the current release, SCOPe 2.08