| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) ![]() |
| Family d.17.3.0: automated matches [228319] (1 protein) not a true family |
| Protein automated matches [228320] (2 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [228321] (2 PDB entries) |
| Domain d4ilfb1: 4ilf B:1-60 [234878] Other proteins in same PDB: d4ilfa2, d4ilfb2 automated match to d4ilfa1 |
PDB Entry: 4ilf (more details), 2 Å
SCOPe Domain Sequences for d4ilfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ilfb1 d.17.3.0 (B:1-60) automated matches {Salmonella typhimurium [TaxId: 99287]}
mdaairqslaklgvqsteiqaspvagmktvlthsgvlyvtddgkhiiqgpmydvsgahpv
Timeline for d4ilfb1: