Lineage for d4ik0b2 (4ik0 B:131-275)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407275Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1407276Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1407277Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
    automatically mapped to Pfam PF01678
  6. 1407278Protein Diaminopimelate epimerase [54508] (2 species)
  7. 1407279Species Escherichia coli [TaxId:83333] [234868] (2 PDB entries)
  8. 1407287Domain d4ik0b2: 4ik0 B:131-275 [234876]
    automated match to d1gqza2
    complexed with iod; mutant

Details for d4ik0b2

PDB Entry: 4ik0 (more details), 2.05 Å

PDB Description: Crystal structure of diaminopimelate epimerase Y268A mutant from Escherichia coli
PDB Compounds: (B:) Diaminopimelate epimerase

SCOPe Domain Sequences for d4ik0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ik0b2 d.21.1.1 (B:131-275) Diaminopimelate epimerase {Escherichia coli [TaxId: 83333]}
rankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvlesherfperan
igfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrvelpggrldia
wkgpghplymtgpavhvadgfihlh

SCOPe Domain Coordinates for d4ik0b2:

Click to download the PDB-style file with coordinates for d4ik0b2.
(The format of our PDB-style files is described here.)

Timeline for d4ik0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ik0b1