SCOPe 2.03: Domain d4ik0b1: 4ik0 B:1-130

Lineage for d4ik0b1 (4ik0 B:1-130)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (2 species)

7. Species Escherichia coli [TaxId:83333] [234868] (2 PDB entries)

8. Domain d4ik0b1: 4ik0 B:1-130 [234875]
   automated match to d1bwza1
   complexed with iod; mutant

Details for d4ik0b1

PDB Entry: 4ik0, 2.05 Å

PDB Description: Crystal structure of diaminopimelate epimerase Y268A mutant from Escherichia coli

PDB Compounds: (B:) Diaminopimelate epimerase

SCOPe Domain Sequences for d4ik0b1:

Sequence; same for both SEQRES and ATOM records:

>d4ik0b1 d.21.1.1 (B:1-130) Diaminopimelate epimerase {Escherichia coli [TaxId: 83333]}
mqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfhy
rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge
pnfepsavpf

Timeline for d4ik0b1:

• d4ik0b1 is new in SCOPe 2.03-stable
  
• d4ik0b1 appears in SCOPe 2.04
  
• d4ik0b1 appears in the current release, SCOPe 2.08