Lineage for d4ik0a2 (4ik0 A:131-274)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546596Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. 2546597Protein Diaminopimelate epimerase [54508] (3 species)
  7. 2546598Species Escherichia coli K-12 [TaxId:83333] [234868] (2 PDB entries)
  8. 2546604Domain d4ik0a2: 4ik0 A:131-274 [234874]
    Other proteins in same PDB: d4ik0b3
    automated match to d1gqza2
    complexed with iod; mutant

Details for d4ik0a2

PDB Entry: 4ik0 (more details), 2.05 Å

PDB Description: Crystal structure of diaminopimelate epimerase Y268A mutant from Escherichia coli
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d4ik0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ik0a2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Escherichia coli K-12 [TaxId: 83333]}
rankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvlesherfperan
igfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrvelpggrldia
wkgpghplymtgpavhvadgfihl

SCOPe Domain Coordinates for d4ik0a2:

Click to download the PDB-style file with coordinates for d4ik0a2.
(The format of our PDB-style files is described here.)

Timeline for d4ik0a2: