Lineage for d4ik0a2 (4ik0 A:131-274)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898719Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1898720Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1898721Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
    automatically mapped to Pfam PF01678
  6. 1898722Protein Diaminopimelate epimerase [54508] (3 species)
  7. 1898723Species Escherichia coli K-12 [TaxId:83333] [234868] (2 PDB entries)
  8. 1898729Domain d4ik0a2: 4ik0 A:131-274 [234874]
    automated match to d1gqza2
    complexed with iod; mutant

Details for d4ik0a2

PDB Entry: 4ik0 (more details), 2.05 Å

PDB Description: Crystal structure of diaminopimelate epimerase Y268A mutant from Escherichia coli
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d4ik0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ik0a2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Escherichia coli K-12 [TaxId: 83333]}
rankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvlesherfperan
igfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrvelpggrldia
wkgpghplymtgpavhvadgfihl

SCOPe Domain Coordinates for d4ik0a2:

Click to download the PDB-style file with coordinates for d4ik0a2.
(The format of our PDB-style files is described here.)

Timeline for d4ik0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ik0a1