![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein) automatically mapped to Pfam PF01678 |
![]() | Protein Diaminopimelate epimerase [54508] (3 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [234868] (2 PDB entries) |
![]() | Domain d4ik0a1: 4ik0 A:1-130 [234873] Other proteins in same PDB: d4ik0b3 automated match to d1bwza1 complexed with iod; mutant |
PDB Entry: 4ik0 (more details), 2.05 Å
SCOPe Domain Sequences for d4ik0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ik0a1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Escherichia coli K-12 [TaxId: 83333]} mqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfhy rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge pnfepsavpf
Timeline for d4ik0a1: