Lineage for d4ik0a1 (4ik0 A:1-130)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184294Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2184295Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2184296Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
    automatically mapped to Pfam PF01678
  6. 2184297Protein Diaminopimelate epimerase [54508] (3 species)
  7. 2184298Species Escherichia coli K-12 [TaxId:83333] [234868] (2 PDB entries)
  8. 2184303Domain d4ik0a1: 4ik0 A:1-130 [234873]
    Other proteins in same PDB: d4ik0b3
    automated match to d1bwza1
    complexed with iod; mutant

Details for d4ik0a1

PDB Entry: 4ik0 (more details), 2.05 Å

PDB Description: Crystal structure of diaminopimelate epimerase Y268A mutant from Escherichia coli
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d4ik0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ik0a1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Escherichia coli K-12 [TaxId: 83333]}
mqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfhy
rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge
pnfepsavpf

SCOPe Domain Coordinates for d4ik0a1:

Click to download the PDB-style file with coordinates for d4ik0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ik0a1: