![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein) automatically mapped to Pfam PF01678 |
![]() | Protein Diaminopimelate epimerase [54508] (2 species) |
![]() | Species Escherichia coli [TaxId:83333] [234868] (2 PDB entries) |
![]() | Domain d4ijzb2: 4ijz B:131-275 [234871] automated match to d1gqza2 complexed with no3 |
PDB Entry: 4ijz (more details), 2 Å
SCOPe Domain Sequences for d4ijzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijzb2 d.21.1.1 (B:131-275) Diaminopimelate epimerase {Escherichia coli [TaxId: 83333]} rankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvlesherfperan igfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrvelpggrldia wkgpghplymtgpavhvydgfihlh
Timeline for d4ijzb2: