SCOPe 2.06: Domain d4ijcb_: 4ijc B:

Lineage for d4ijcb_ (4ijc B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (26 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [229247] (2 PDB entries)

8. Domain d4ijcb_: 4ijc B: [234865]
   automated match to d4ijrc_
   complexed with gol, so4

Details for d4ijcb_

PDB Entry: 4ijc, 2.1 Å

PDB Description: Crystal structure of arabinose dehydrogenase Ara1 from Saccharomyces cerevisiae

PDB Compounds: (B:) D-arabinose dehydrogenase [NAD(P)+] heavy chain

SCOPe Domain Sequences for d4ijcb_:

Sequence; same for both SEQRES and ATOM records:

>d4ijcb_ c.1.7.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mlhpktteiyfslnngvripalglgtanpheklaetkqavkaaikagyrhidtawayete
pfvgeaikelledgsikredlfittkvwpvlwdevdrslneslkalgleyvdlllqhwpl
cfekikdpkgisglvktpvddsgktmyaadgdyletykqlekiyldpndhrvraigvsnf
sieylerlikecrvkptvnqvethphlpqmelrkfcfmhdilltaysplgshgapnlkip
lvkklaekynvtgndllisyhirqgtiviprslnpvrisssiefasltkdelqelndfge
kypvrfidepfaailpeftgngpnldnlky

Timeline for d4ijcb_:

• d4ijcb_ first appeared in SCOPe 2.03
  
• d4ijcb_ appears in SCOPe 2.05
  
• d4ijcb_ appears in SCOPe 2.07
  
• d4ijcb_ appears in the current release, SCOPe 2.08