Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (26 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [229247] (2 PDB entries) |
Domain d4ijcb_: 4ijc B: [234865] automated match to d4ijrc_ complexed with gol, so4 |
PDB Entry: 4ijc (more details), 2.1 Å
SCOPe Domain Sequences for d4ijcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijcb_ c.1.7.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mlhpktteiyfslnngvripalglgtanpheklaetkqavkaaikagyrhidtawayete pfvgeaikelledgsikredlfittkvwpvlwdevdrslneslkalgleyvdlllqhwpl cfekikdpkgisglvktpvddsgktmyaadgdyletykqlekiyldpndhrvraigvsnf sieylerlikecrvkptvnqvethphlpqmelrkfcfmhdilltaysplgshgapnlkip lvkklaekynvtgndllisyhirqgtiviprslnpvrisssiefasltkdelqelndfge kypvrfidepfaailpeftgngpnldnlky
Timeline for d4ijcb_: